Pyricularia oryzae: MGG_00466 Help Entry MGG_00466         CDS       T01027                                  Name (RefSeq) cell division control protein 42   KO K04393   cell division control protein 42 Organism mgr  Pyricularia oryzae Pathway mgr04011   MAPK signaling pathway - yeast mgr04144   Endocytosis mgr04517   IgSF CAM signaling mgr04518   Integrin signaling mgr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mgr00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     MGG_00466   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     MGG_00466    04518 Integrin signaling     MGG_00466  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     MGG_00466  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     MGG_00466  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mgr04131]     MGG_00466    03036 Chromosome and associated proteins [BR:mgr03036]     MGG_00466   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mgr04147]     MGG_00466    04031 GTP-binding proteins [BR:mgr04031]     MGG_00466 Membrane trafficking [BR:mgr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     MGG_00466  Endocytosis   Lipid raft mediated endocytosis    GRAF1-dependent endocytosis     MGG_00466   Macropinocytosis    Ras GTPases     MGG_00466 Chromosome and associated proteins [BR:mgr03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     MGG_00466 Exosome [BR:mgr04147]  Exosomal proteins   Exosomal proteins of microglial cells    MGG_00466   Exosomal proteins of breast milk    MGG_00466 GTP-binding proteins [BR:mgr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     MGG_00466 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  2674265 NCBI-ProteinID:  XP_003718598 UniProt:  G4NC11 LinkDB All DBs Position 5:2796492..2800723 Genome browser AA seq 194 aa AA seqDB search MVVATIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGDEPYTLGLFDT AGQEDYDRLRPLSYPQTDVFLVCFSVTSPASFENVREKWFPEVHHHCPGVPCLIVGTQVD LRDDPSVREKLSKQKMQPVRREDGERMAKELGAVKYVECSALTQYKLKDVFDEAIVAALE PPTPKRKSKKCLIL NT seq 585 nt NT seq  +upstreamnt  +downstreamnt atggtggttgcaacgattaaatgcgttgtcgtcggcgacggtgccgtcggtaaaacatgt ctccttatcagctacacaacaaacaagtttccgtccgaatacgttccgaccgtcttcgac aactacgcagtgacggtaatgatcggtgacgagccgtacacactgggacttttcgatacg gcaggacaagaagattacgacaggctgcgacccctatcatacccacaaaccgacgtcttt ctcgtttgcttcagcgtcacatcgccagcttcattcgagaacgtgagggagaagtggttc cccgaggttcaccaccactgccccggcgtaccctgcctcatcgtcggtacacaagttgat ttgagggatgatcccagcgttcgggagaagctgagcaagcagaagatgcagccagtgcgg agggaggacggcgagcggatggctaaagaactcggtgcggttaagtacgtcgagtgcagt gctctgacgcagtacaagttgaaggatgtctttgatgaggcaatcgttgctgccctagag ccgccgacacccaagaggaaatccaaaaagtgcctgatcctttga

DBGET integrated database retrieval system