Pyricularia oryzae: MGG_02463 Help Entry MGG_02463         CDS       T01027                                  Name (RefSeq) hypothetical protein   KO K03008   DNA-directed RNA polymerase II subunit RPB11 Organism mgr  Pyricularia oryzae Pathway mgr03020   RNA polymerase mgr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mgr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     MGG_02463   09124 Replication and repair    03420 Nucleotide excision repair     MGG_02463  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mgr03021]     MGG_02463    03400 DNA repair and recombination proteins [BR:mgr03400]     MGG_02463 Transcription machinery [BR:mgr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Core subunits      MGG_02463 DNA repair and recombination proteins [BR:mgr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       MGG_02463 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_L_2 RNA_pol_L DUF5778 Motif Other DBs NCBI-GeneID:  2681560 NCBI-ProteinID:  XP_003709257 UniProt:  G4MRX6 LinkDB All DBs Position 1:complement(1961754..1963124) Genome browser AA seq 130 aa AA seqDB search MNAPDRFELFLLEPGEEKLTETINTSMSNTSDFTFKKEDHTLGNMLTEHLKQHPNVLMAG YKVSHPNVPEFFLRIQTDGKVTPKACLLDACRTILHSLGQIRTEFTREFELRRMVAAGEQ QQNGEHGHGL NT seq 393 nt NT seq  +upstreamnt  +downstreamnt atgaacgctcccgaccgattcgagctgtttctcctggagccgggagaggagaaactgacc gaaaccatcaacacatccatgtcaaacacgtcagactttacgttcaaaaaggaagaccac acattgggcaacatgctcaccgagcacctcaagcagcaccccaatgttctgatggcaggc tacaaagtttctcaccctaacgtgcccgagttcttcctgcgcatccagactgacggcaag gtgacgcccaaggcgtgcttgctggacgcctgccgcacgatcctgcacagtctcggccag atcaggaccgagttcacgcgggagttcgagctcaggaggatggttgcagccggcgagcag cagcagaacggagagcatggccatgggctctag

DBGET integrated database retrieval system