Pyricularia oryzae: MGG_07176 Help Entry MGG_07176         CDS       T01027                                  Name (RefSeq) GTP-binding protein rhoA   KO K04513   Ras homolog gene family, member A Organism mgr  Pyricularia oryzae Pathway mgr04011   MAPK signaling pathway - yeast mgr04081   Hormone signaling mgr04144   Endocytosis mgr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:mgr00001]  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     MGG_07176   09133 Signaling molecules and interaction    04081 Hormone signaling     MGG_07176  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     MGG_07176  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     MGG_07176  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mgr04131]     MGG_07176   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mgr04147]     MGG_07176    04031 GTP-binding proteins [BR:mgr04031]     MGG_07176 Membrane trafficking [BR:mgr04131]  Endocytosis   Lipid raft mediated endocytosis    RhoA-dependent endocytosis     MGG_07176 Exosome [BR:mgr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MGG_07176   Exosomal proteins of other body fluids (saliva and urine)    MGG_07176   Exosomal proteins of colorectal cancer cells    MGG_07176   Exosomal proteins of bladder cancer cells    MGG_07176 GTP-binding proteins [BR:mgr04031]  Small (monomeric) G-proteins   Rho Family    RhoA/B/C [OT]     MGG_07176 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU SRPRB baeRF_family3 Motif Other DBs NCBI-GeneID:  2683159 NCBI-ProteinID:  XP_003715379 UniProt:  G4MTL4 LinkDB All DBs Position 2:6646192..6648620 Genome browser AA seq 193 aa AA seqDB search MAEIRRKLVIVGDGACGKTCLLIVFSKGTFPEVYVPTVFENYVADVEVDGKHVELALWDT AGQEDYDRLRPLSYPDSHVILICFAIDSPDSLDNVQEKWISEVLHFCSGLPIILVGCKKD LRYDQKTIEELRKTSQKPVSPEDGEEIKKKIGAYKYLECSAKTNEGVREVFEHATRAALL SRHKTKKKKCLIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atggccgaaatccgccgcaagctggtcatcgtcggtgacggtgcctgcggtaagacatgt ttgttgattgtgttctctaagggcaccttccccgaggtctacgtccccaccgtcttcgaa aactacgtcgctgatgtggaggtcgatggcaagcacgtcgagttggcactatgggatact gccggccaggaggattacgatcgtctgcgccccttgtcctaccccgactctcacgttatc ctgatttgcttcgccatcgactctcccgactcccttgacaacgtccaagagaagtggatc tccgaggtccttcacttctgctcgggcctgccaattatccttgttggttgcaagaaggat cttcggtatgaccagaagaccattgaggagcttcgcaagaccagccagaagcccgtctca cctgaggatggtgaggagattaagaagaagattggtgcctacaagtacctcgagtgctcg gccaagaccaacgagggtgtccgtgaggtgttcgagcatgctacacgagctgccctcctg tctcgccacaagaccaagaagaagaagtgcctcatcctctaa

DBGET integrated database retrieval system