Pyricularia oryzae: MGG_07391 Help Entry MGG_07391         CDS       T01027                                  Name (RefSeq) hypothetical protein   KO K03017   DNA-directed RNA polymerase II subunit RPB9 Organism mgr  Pyricularia oryzae Pathway mgr03020   RNA polymerase mgr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mgr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     MGG_07391   09124 Replication and repair    03420 Nucleotide excision repair     MGG_07391  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mgr03021]     MGG_07391    03400 DNA repair and recombination proteins [BR:mgr03400]     MGG_07391 Transcription machinery [BR:mgr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol II specific subunits      MGG_07391 DNA repair and recombination proteins [BR:mgr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       MGG_07391 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_ribbon_RPB9 Zn_ribbon_TFIIS C1_1 Motif Other DBs NCBI-GeneID:  2683311 NCBI-ProteinID:  XP_003711269 UniProt:  G4N0C4 LinkDB All DBs Position 3:421002..422580 Genome browser AA seq 131 aa AA seqDB search MSSPMSTSGQDGQQSHTKKPVEFQFCAECSNMLYPKEDEETRTLQFTCRTCHYTTNASNT CVFRNELNSSASLHAGIIEGMGKDPTLPRAKKTCQYCGFDEMVFFQAQQRTAETGMKQIY VCVECSKPQTD NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgccaatgtcaacttccggccaggatggccaacaatcgcacaccaaaaagccc gtcgagtttcaattctgcgccgaatgctccaacatgctctaccccaaggaagacgaggag acgcgcacacttcagttcacctgccgaacatgccactacacaaccaacgcgagcaacact tgcgtgttccgcaacgagctcaacagctccgccagccttcacgccggaatcatcgagggc atgggcaaggacccgacgctcccccgcgccaagaagacttgccaatactgtggctttgac gagatggtctttttccaagctcagcagcgaactgccgagaccggaatgaaacaaatttat gtttgcgtcgagtgctccaagcctcagacggactga

DBGET integrated database retrieval system