Pyricularia oryzae: MGG_11667 Help Entry MGG_11667         CDS       T01027                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism mgr  Pyricularia oryzae Pathway mgr03020   RNA polymerase mgr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:mgr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     MGG_11667   09124 Replication and repair    03420 Nucleotide excision repair     MGG_11667  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:mgr03021]     MGG_11667    03400 DNA repair and recombination proteins [BR:mgr03400]     MGG_11667 Transcription machinery [BR:mgr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      MGG_11667   RNA polymerase III system    RNA polymerase III      MGG_11667   RNA polymerase I system    RNA polymerase I      MGG_11667 DNA repair and recombination proteins [BR:mgr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       MGG_11667 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Zn_ribbon_RPAB4 Zn_ribbon_8 HypA zf-C2H2_ZN142 DUF7129 FYDLN_acid Motif Other DBs NCBI-GeneID:  5050833 NCBI-ProteinID:  XP_003719039 UniProt:  G4NEH8 LinkDB All DBs Position 5:complement(4141842..4142602) Genome browser AA seq 76 aa AA seqDB search MSREEYQMPTGGASQTQGGASGGAVSAPPSQPILYSCGDCGFKFEMNRRDPIRCTECGCR VLYKNRTNRMIEFEAR NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtctcgcgaagagtaccaaatgcccaccggcggcgccagccagacccaaggcggtgcc agcggcggcgccgtgtctgcccctcccagccagcccattctctacagctgcggcgactgc ggcttcaagtttgagatgaaccgccgcgaccctatccgatgcaccgagtgcggatgccgt gtcttgtacaagaacagaacgaatcgcatgatcgagtttgaagcgcgataa

DBGET integrated database retrieval system