Pyricularia oryzae: MGG_14582
Help
Entry
MGG_14582 CDS
T01027
Name
(RefSeq) hypothetical protein
KO
K27383
non-classical export protein 1
Organism
mgr
Pyricularia oryzae
Brite
KEGG Orthology (KO) [BR:
mgr00001
]
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02000 Transporters [BR:
mgr02000
]
MGG_14582
Transporters [BR:
mgr02000
]
Other transporters
Others
MGG_14582
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
NCE101
Motif
Other DBs
NCBI-GeneID:
5051539
NCBI-ProteinID:
XP_003709401
UniProt:
G4ML53
LinkDB
All DBs
Position
1:complement(2410465..2410709)
Genome browser
AA seq
60 aa
AA seq
DB search
MPPPTYIISRVADPVFAVFIGLSAAVTRVRREEKEKGRTSAETMDAFKRRLRYTVGMSSN
NT seq
183 nt
NT seq
+upstream
nt +downstream
nt
atgcctcctcctacgtatataatttcgagggtggcagatcccgtctttgctgtgtttatc
ggcctctcagccgccgttaccagagtcaggcgtgaggagaaggaaaagggaaggacctcg
gctgagactatggacgctttcaagagacgcctcaggtatactgtcggcatgagcagtaat
taa
DBGET
integrated database retrieval system