Pyricularia oryzae: MGG_15351 Help Entry MGG_15351         CDS       T01027                                  Name (RefSeq) hypothetical protein   KO K00006   glycerol-3-phosphate dehydrogenase (NAD+) [EC:1.1.1.8] Organism mgr  Pyricularia oryzae Pathway mgr00564   Glycerophospholipid metabolism mgr01110   Biosynthesis of secondary metabolites mgr04011   MAPK signaling pathway - yeast Brite KEGG Orthology (KO) [BR:mgr00001]  09100 Metabolism   09103 Lipid metabolism    00564 Glycerophospholipid metabolism     MGG_15351  09130 Environmental Information Processing   09132 Signal transduction    04011 MAPK signaling pathway - yeast     MGG_15351 Enzymes [BR:mgr01000]  1. Oxidoreductases   1.1  Acting on the CH-OH group of donors    1.1.1  With NAD+ or NADP+ as acceptor     1.1.1.8  glycerol-3-phosphate dehydrogenase (NAD+)      MGG_15351 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NAD_Gly3P_dh_C DAP_B Motif Other DBs NCBI-GeneID:  12986848 NCBI-ProteinID:  XP_003715981 UniProt:  G4NAL9 LinkDB All DBs Position 4:354194..355447 Genome browser AA seq 109 aa AA seqDB search MLKVAREFFGESVDPFTILLENAGVADGITSCISGRNFRCANMAVKRGLSVVEIEEKELN GQQLQGTFTAKESNSLLNARGRQGDYPLFTTFALPMSTCVVNPTISEST NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgctcaaagttgcccgcgaattctttggggagtcggtcgatccgttcacgatcctgctc gaaaatgccggcgtggctgacggtatcacatcatgcatcagtggaaggaatttccgttgc gcgaacatggcagtcaagcgaggtttatccgttgttgagatcgaggagaaggaactcaat ggacagcagttgcagggaacctttaccgccaaggaatcaaacagcctgttgaacgcacgt ggcaggcagggcgattatcccctgtttaccacttttgcactgccaatgagcacttgcgtg gtcaatccaacgatttccgagagtacatga

DBGET integrated database retrieval system