Pyricularia oryzae: MGG_15645 Help Entry MGG_15645         CDS       T01027                                  Name (RefSeq) hypothetical protein   KO K10418   dynein light chain LC8-type Organism mgr  Pyricularia oryzae Pathway mgr04814   Motor proteins Brite KEGG Orthology (KO) [BR:mgr00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     MGG_15645  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:mgr03037]     MGG_15645    04812 Cytoskeleton proteins [BR:mgr04812]     MGG_15645 Cilium and associated proteins [BR:mgr03037]  Motile cilia and associated proteins   Dynein arm    MGG_15645 Cytoskeleton proteins [BR:mgr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      MGG_15645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  12984593 NCBI-ProteinID:  XP_003714113 UniProt:  G4MX14 LinkDB All DBs Position 2:complement(2701789..2703662) Genome browser AA seq 97 aa AA seqDB search MAEANPATREKLDAQIKAADMNDDLAMEIIDVAQEAMSRLTIEKDIAEHVKKTFDERKGP TWHCIVGRNFGSFVTHESKHFLYFYLGHCAFLVFKTQ NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atggcagaagcgaaccccgccacacgggagaaattggacgcccagatcaaggcggccgac atgaatgatgatctagcaatggagatcattgacgtcgcccaagaggcgatgtccaggctc actatcgagaaggacattgcggagcatgtgaagaagaccttcgacgagaggaagggcccc acatggcactgcatcgtcggtcggaactttggcagctttgtcacccacgagtccaagcac tttctatacttctaccttggccactgtgctttcctcgtctttaagacgcagtag

DBGET integrated database retrieval system