Magnetospirillum gryphiswaldense MSR-1: MSR1_07630 Help Entry MSR1_07630        CDS       T05662                                  Symbol acpP_1 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism mgry  Magnetospirillum gryphiswaldense MSR-1 Pathway mgry01100   Metabolic pathways mgry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mgry00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MSR1_07630 (acpP_1)    00074 Mycolic acid biosynthesis     MSR1_07630 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MSR1_07630 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AVM73268 UniProt:  V6F2J3 LinkDB All DBs Position 761736..761969 Genome browser AA seq 77 aa AA seqDB search MSDVAERVKKIVVEHLGVEEAKVTENASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA EKILTVKDAIDFISKAA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgacgtcgccgagcgggttaagaagattgtcgttgagcatctgggcgttgaagaa gccaaggtgaccgagaacgccagcttcatcgatgacctgggcgccgacagcctcgacacc gtcgagctggtcatggcctttgaagaagaattcggctgcgaaatccccgatgacgccgct gaaaagattttgaccgtcaaggacgcgatcgacttcatctcgaaggccgcgtaa

DBGET integrated database retrieval system