Magnetospirillum gryphiswaldense MSR-1: MSR1_10020 Help Entry MSR1_10020        CDS       T05662                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mgry  Magnetospirillum gryphiswaldense MSR-1 Pathway mgry01100   Metabolic pathways mgry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mgry00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MSR1_10020    00074 Mycolic acid biosynthesis     MSR1_10020   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MSR1_10020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AVM73501 LinkDB All DBs Position 990531..990782 Genome browser AA seq 83 aa AA seqDB search MKTLIVDALKLEDLSPDDIDAAEPLFGDTGLGLDSIDALELGVAIRKTFGIKIDTVTEDV RHHFASIDNLAAFIRAQQGNAQE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt ttgaagacattgatcgtcgatgcgttgaagttggaggatctctcgcctgacgacatcgac gccgccgaacccctgttcggcgataccgggttgggccttgattccatcgacgcgctggaa ctgggggtggccatccgcaagaccttcggcatcaagatcgacacggtgaccgaggacgtg cgtcaccacttcgccagcatcgacaatctggccgccttcatccgcgcccagcaagggaac gcccaggaatga

DBGET integrated database retrieval system