Magnetospirillum gryphiswaldense MSR-1: MSR1_10030 Help Entry MSR1_10030        CDS       T05662                                  Symbol acpP_2 Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism mgry  Magnetospirillum gryphiswaldense MSR-1 Pathway mgry01100   Metabolic pathways mgry01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mgry00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MSR1_10030 (acpP_2)    00074 Mycolic acid biosynthesis     MSR1_10030 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MSR1_10030 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AVM73502 UniProt:  V6EZ35 LinkDB All DBs Position 990779..991024 Genome browser AA seq 81 aa AA seqDB search MTRDEIQTSLAGYLTEMFEVAPESITAEARLYEDLDLDSIDAVDLVVKLQELTGRKIKPE QFKTVRTVGDVVDRVHELFNE NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgacccgcgacgaaattcagacctctctcgccggctatctgaccgaaatgttcgaggtg gcgccggaaagcatcaccgccgaggcccgcctgtacgaggatctcgacctggacagcatc gacgccgtcgatctggtggtgaagttgcaggaattgaccgggcgcaagatcaagcccgag cagttcaagaccgtccgcaccgtcggcgacgtggtggaccgcgtgcatgaactgttcaac gaataa

DBGET integrated database retrieval system