Methanosarcina hadiensis: RSJ42_12045 Help Entry RSJ42_12045       CDS       T10775                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mhab  Methanosarcina hadiensis Pathway mhab03010   Ribosome Brite KEGG Orthology (KO) [BR:mhab00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     RSJ42_12045   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     RSJ42_12045  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mhab03011]     RSJ42_12045    04121 Ubiquitin system [BR:mhab04121]     RSJ42_12045   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mhab04147]     RSJ42_12045 Ribosome [BR:mhab03011]  Ribosomal proteins   Eukaryotes    Small subunit     RSJ42_12045   Archaea     RSJ42_12045 Ubiquitin system [BR:mhab04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    RSJ42_12045 Exosome [BR:mhab04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    RSJ42_12045   Exosomal proteins of colorectal cancer cells    RSJ42_12045 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e Rcat_RNF216 Zn_ribbon_RPB9 IBR_1 Zn_Ribbon_TF Cas12f1-like_TNB DUF6671 Zn_ribbon_3 MqsA_antitoxin DUF1451 Zn_ribbon_IS1595 Zn_ribbon_NOB1 Motif Other DBs NCBI-ProteinID:  XMB88052 LinkDB All DBs Position 2841274..2841423 Genome browser AA seq 49 aa AA seqDB search MAVKNYYKVQGDSVTRLKQFCPRCGPGVFLADHKNRLACGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaaaattactataaagtccagggcgactccgtaaccagactcaaacagttc tgtcccagatgcggacccggtgtattccttgccgaccacaaaaaccgcctcgcctgcgga aagtgcggctacaccgagttcaagaaataa

DBGET integrated database retrieval system