Methanosarcina hadiensis: RSJ42_18500 Help Entry RSJ42_18500       CDS       T10775                                  Symbol groES Name (GenBank) co-chaperone GroES   KO K04078   chaperonin GroES Organism mhab  Methanosarcina hadiensis Brite KEGG Orthology (KO) [BR:mhab00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mhab03110]     RSJ42_18500 (groES)    03029 Mitochondrial biogenesis [BR:mhab03029]     RSJ42_18500 (groES) Chaperones and folding catalysts [BR:mhab03110]  Heat shock proteins   HSP10    RSJ42_18500 (groES) Mitochondrial biogenesis [BR:mhab03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     RSJ42_18500 (groES) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cpn10 Motif Other DBs NCBI-ProteinID:  XMB89239 LinkDB All DBs Position 4320009..4320287 Genome browser AA seq 92 aa AA seqDB search MIVKPIGERVLLKHQKKEEVTRGGIYIPESARQEKKEGIVIAVGTFEDGKELPLKKGDHV IYGGYQADEIEIDDEKYVFVDFKDILATVVEE NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgattgtcaaacctattggcgaacgagtgttactcaagcaccagaagaaagaagaagtg accagaggcgggatttatatcccggaatccgcacggcaggaaaagaaagaaggaattgtt attgccgtgggaacctttgaagacgggaaagaactccctctgaagaaaggggatcacgtg atttacgggggatatcaggctgatgagatcgagatcgatgacgaaaaatatgtttttgtc gactttaaagatattctggcaacagttgttgaagaataa

DBGET integrated database retrieval system