Moraxella haemolytica: LU276_01715 Help Entry LU276_01715       CDS       T09918                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mhac  Moraxella haemolytica Pathway mhac01100   Metabolic pathways mhac01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mhac00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LU276_01715 (acpP)    00074 Mycolic acid biosynthesis     LU276_01715 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LU276_01715 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  WII95586 LinkDB All DBs Position 372467..372700 Genome browser AA seq 77 aa AA seqDB search MSDIEAKVKDAVAEQLGLNVADINNEASFMDDLGADSLDLVELVMAFESNFGITIPDEDS AELTTVQKAIDYVTAKL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagctaaagtaaaagacgcagtggctgagcaacttggtctaaatgtt gctgacatcaacaatgaagcatcatttatggatgacttgggtgctgactctctagatttg gttgaactggtgatggcatttgaaagcaactttggtattaccattcctgatgaagattct gctgaattgaccaccgtacaaaaagccattgactatgtaactgctaagctataa

DBGET integrated database retrieval system