Mycobacterium haemophilum: B586_10690 Help Entry B586_10690        CDS       T04111                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism mhad  Mycobacterium haemophilum Pathway mhad03060   Protein export mhad03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:mhad00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     B586_10690  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     B586_10690  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:mhad02044]     B586_10690 Secretion system [BR:mhad02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    B586_10690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E HTH_17 Motif Other DBs NCBI-ProteinID:  AKN16908 LinkDB All DBs Position complement(2485789..2486010) Genome browser AA seq 73 aa AA seqDB search MGSLSPWHWAILAVVVVLLFGAKKLPDAARSLGKSMRIFKSELREMQTENKAEASALDPP SSTEQGHTEARPA NT seq 222 nt NT seq  +upstreamnt  +downstreamnt gtgggcagtcttagtccgtggcactgggcgatcctcgctgtcgtcgtggtcctgctgttc ggtgccaagaagctccccgatgcggcgcgctcgttgggtaagtcgatgcgcatcttcaag tccgaactacgtgaaatgcagaccgagaacaaggcggaagcgtctgcccttgacccgccg tcgtcgaccgagcaggggcacaccgaggcgcggccggcttag

DBGET integrated database retrieval system