Mycobacterium haemophilum: B586_17065 Help Entry B586_17065        CDS       T04111                                  Name (GenBank) glutaredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism mhad  Mycobacterium haemophilum Brite KEGG Orthology (KO) [BR:mhad00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     B586_17065 Enzymes [BR:mhad01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      B586_17065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Thioredoxin_2 Glrx-like GST_N_3 Thioredoxin GST_N SH3BGR HeH Motif Other DBs NCBI-ProteinID:  AKN17891 LinkDB All DBs Position complement(1107888..1108142) Genome browser AA seq 84 aa AA seqDB search MTNAALTIYTTSWCGFCVRLKTALKANGISYDEVDIDHDASAAEFVGSVNGGNRTVPTVK FADGSTLTNPSAGAVQAKLAEITG NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccaatgctgcgctcaccatctacacgacgtcgtggtgcggcttctgtgttcggcta aagacagcgctcaaagccaacggaatctcctacgacgaggtcgacatcgaccatgacgcc tcggccgcggagttcgtcggctcggtcaacggcggcaacaggacggtcccgacggtgaag ttcgccgacgggtcgacactgaccaacccaagcgcgggcgcagtccaggcgaagctggcc gagatcactggctaa

DBGET integrated database retrieval system