Mannheimia haemolytica D153: F382_06070 Help Entry F382_06070        CDS       T02746                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mhae  Mannheimia haemolytica D153 Pathway mhae01100   Metabolic pathways mhae01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mhae00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     F382_06070 (acpP)    00074 Mycolic acid biosynthesis     F382_06070 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     F382_06070 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5783 Motif Other DBs NCBI-ProteinID:  AGQ25549 LinkDB All DBs Position complement(1177969..1178199) Genome browser AA seq 76 aa AA seqDB search MSIEERVKKIIVDQLGAKAEDVKPEASFIEDLGADSLDTVELVMALEEEFDIEIPDEEAE KITTVQSAIDYVQNNQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagcattgaagaacgcgtaaaaaaaatcattgttgatcaacttggcgcgaaagcagaa gatgtaaaaccagaagcttcattcattgaagatttaggtgcagattctttagacactgtt gaattagtaatggctttagaagaagaattcgatatcgaaattccagatgaagaagctgaa aaaattactacagttcaatcagcaattgattacgttcaaaacaatcaataa

DBGET integrated database retrieval system