Microbispora hainanensis: OHB01_01335 Help Entry OHB01_01335       CDS       T09710                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mhai  Microbispora hainanensis Pathway mhai00998   Biosynthesis of various antibiotics mhai01100   Metabolic pathways mhai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mhai00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     OHB01_01335    00074 Mycolic acid biosynthesis     OHB01_01335   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     OHB01_01335 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  WUP83220 LinkDB All DBs Position complement(285170..285442) Genome browser AA seq 90 aa AA seqDB search MTRPEIVAAVVRSIGEVLQREISDVTEDTRLFDDLQLDSTSILELLMAVEDTMDVEIDPE GLDMDSFRTVGTLVDYLQGLVDLVATGNAG NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgacccgacccgagatcgtcgcagccgtcgtccggtccatcggtgaggtcctccagcgg gagatctccgacgtgacggaggacacccggctgttcgacgacctccagctggactccacg tcgatcctcgaactgctcatggccgtggaggacacaatggacgtcgagatcgaccccgag ggcctggacatggacagcttccgcactgtcggcaccctggtcgactacctccaggggctc gtggacctcgtcgccaccggaaacgcgggctga

DBGET integrated database retrieval system