Mannheimia haemolytica USMARC_2286: N220_02775 Help Entry N220_02775        CDS       T02758                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism mhal  Mannheimia haemolytica USMARC_2286 Pathway mhal00290   Valine, leucine and isoleucine biosynthesis mhal00650   Butanoate metabolism mhal00660   C5-Branched dibasic acid metabolism mhal00770   Pantothenate and CoA biosynthesis mhal01100   Metabolic pathways mhal01110   Biosynthesis of secondary metabolites mhal01210   2-Oxocarboxylic acid metabolism mhal01230   Biosynthesis of amino acids Module mhal_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine mhal_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:mhal00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     N220_02775    00660 C5-Branched dibasic acid metabolism     N220_02775   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     N220_02775   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     N220_02775 Enzymes [BR:mhal01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      N220_02775 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 ACT_4 bHLH-TF_ACT-like_plant Motif Other DBs NCBI-ProteinID:  AGR74322 LinkDB All DBs Position complement(551913..552131) Genome browser AA seq 72 aa AA seqDB search MEEYQLTLKANKRPETLERILRVIRHRGFEVKCLNVESTDSAFNLNFTLASKRPLSLLSH QLEKLFDIIEIN NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atggaagaatatcaattaacgcttaaagctaacaaacgccctgaaaccttagagcgtatt ttacgggttatacgtcaccgtggttttgaggtgaaatgcttaaatgtagaatcaacagac agcgcctttaacctaaattttacattagcaagtaaacgtccactctctcttttaagccat caattagaaaaactgtttgatatcattgaaatcaattaa

DBGET integrated database retrieval system