Mixta hanseatica: K6958_08600 Help Entry K6958_08600       CDS       T08912                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mhan  Mixta hanseatica Pathway mhan00998   Biosynthesis of various antibiotics mhan01100   Metabolic pathways mhan01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mhan00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K6958_08600 (acpP)    00074 Mycolic acid biosynthesis     K6958_08600 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K6958_08600 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH EutQ Ribosomal_L50 DUF6952 Motif Other DBs NCBI-ProteinID:  UQY45693 LinkDB All DBs Position 1779364..1779600 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIISEQLGVKQEEVTNEKSFVEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQAAIDYINSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgaagaacgcgttaagaaaatcatctccgagcagcttggcgttaagcag gaagaagtcaccaacgaaaaatctttcgttgaagatcttggcgctgattctcttgatacc gttgagctggtaatggctctggaagaagagtttgatactgagattccggacgaagaagct gagaagatcactaccgttcaggctgccattgattacatcaatagccatcaggcctaa

DBGET integrated database retrieval system