Mixta hanseatica: K6958_19535 Help Entry K6958_19535       CDS       T08912                                  Symbol zapB Name (GenBank) cell division protein ZapB   KO K09892   cell division protein ZapB Organism mhan  Mixta hanseatica Brite KEGG Orthology (KO) [BR:mhan00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mhan03036]     K6958_19535 (zapB) Chromosome and associated proteins [BR:mhan03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     K6958_19535 (zapB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB CtIP_N Leu_zip Seryl_tRNA_N UPF0242 Nuf2_DHR10-like USHBP1_PDZ-bd PspA_IM30 DUF4763 YabA DUF3450 KASH_CCD DivIC ERM_helical COG6_N Herpes_UL6 bZIP_1 dCache_2 Not3 FlaC_arch DUF5660 bZIP_2 Mod_r WipA_N COG3_N HALZ APG6_N Occludin_ELL ADIP Cnn_1N DUF2968 CCDC138_cc DUF6262 DUF6026 FapA Motif Other DBs NCBI-ProteinID:  UQY43993 LinkDB All DBs Position complement(4128681..4128920) Genome browser AA seq 79 aa AA seqDB search MSFEVFEKLEAKVQQAIDTITLLQMEIEELKEQNNSLKHEVQQASGNSEALVRENQHLKE EQVQWQERLRALLGKMEEV NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgtcatttgaagtattcgagaaactggaagcaaaagtacagcaggcgattgataccatc acgctgctgcagatggaaattgaagagctgaaagaacagaacaatagcctgaaacatgaa gtacagcaggcctcgggaaacagtgaagcgctggtgcgtgaaaatcagcacctgaaagaa gagcaggttcagtggcaggaacgcctgcgggctttgttaggtaagatggaagaagtctaa

DBGET integrated database retrieval system