Mannheimia haemolytica 89010807N lktA-: VK67_02035 Help Entry VK67_02035        CDS       T03750                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mhay  Mannheimia haemolytica 89010807N lktA- Pathway mhay01100   Metabolic pathways mhay01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mhay00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     VK67_02035    00074 Mycolic acid biosynthesis     VK67_02035   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     VK67_02035 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5783 Motif Other DBs NCBI-ProteinID:  AKA13123 UniProt:  A0A248ZX08 LinkDB All DBs Position 397408..397638 Genome browser AA seq 76 aa AA seqDB search MSIEERVKKIIVDQLGAKAEDVKPEASFIEDLGADSLDTVELVMALEEEFDIEIPDEEAE KITTVQSAIDYVQNNQ NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgagcattgaagaacgcgtaaaaaaaatcattgttgatcaacttggcgcgaaagcagaa gatgtaaaaccagaagcttcattcattgaagatttaggtgcagattctttagacactgtt gaattagtaatggctttagaagaagaattcgatatcgaaattccagatgaagaagctgaa aaaattactacagttcaatcagcaattgattacgttcaaaacaatcaataa

DBGET integrated database retrieval system