Mannheimia haemolytica 89010807N lktA-: VK67_04760 Help Entry VK67_04760        CDS       T03750                                  Symbol groES Name (GenBank) molecular chaperone GroES   KO K04078   chaperonin GroES Organism mhay  Mannheimia haemolytica 89010807N lktA- Brite KEGG Orthology (KO) [BR:mhay00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mhay03110]     VK67_04760 (groES)    03029 Mitochondrial biogenesis [BR:mhay03029]     VK67_04760 (groES) Chaperones and folding catalysts [BR:mhay03110]  Heat shock proteins   HSP10    VK67_04760 (groES) Mitochondrial biogenesis [BR:mhay03029]  Mitochondrial protein import machinery   Matrix    Other matrix factors     VK67_04760 (groES) SSDB OrthologParalogGFIT Motif Pfam:  Cpn10 Peptidase_M17 Cupin_6 Motif Other DBs NCBI-ProteinID:  AKA13619 UniProt:  A0A248ZY51 LinkDB All DBs Position 926872..927162 Genome browser AA seq 96 aa AA seqDB search MALRPLHDKVILKREEVETKSAGGIVLTGSAATKSTRGKVIAVGTGRILDNGSVQPLAVK VGDVVIFNEGYGVKTEKIDGEEVLILAEHDILAIVE NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggcacttcgtccattacacgataaagttattttaaaacgtgaagaagttgaaacaaaa tcggcaggcggtattgttttaaccggttcggcagcaacaaaatcaacccgtggcaaagta attgcagtaggaacaggtcgcattttagacaatggttctgttcagcctttagcagttaaa gtgggcgatgtagtgatttttaacgaaggctacggcgtaaaaaccgagaaaattgacggc gaagaagtgctaattttagcagagcacgatattttggcgattgtagaataa

DBGET integrated database retrieval system