Methanohalophilus halophilus: BHR79_03820 Help Entry BHR79_03820       CDS       T04572                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism mhaz  Methanohalophilus halophilus Pathway mhaz03010   Ribosome Brite KEGG Orthology (KO) [BR:mhaz00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     BHR79_03820   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     BHR79_03820  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mhaz03011]     BHR79_03820    04121 Ubiquitin system [BR:mhaz04121]     BHR79_03820 Ribosome [BR:mhaz03011]  Ribosomal proteins   Eukaryotes    Large subunit     BHR79_03820   Archaea     BHR79_03820 Ubiquitin system [BR:mhaz04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    BHR79_03820 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 Zn_ribbon_3 Zn_ribbon_ZPR1 DZR zf-AtTam37 Cas12f1-like_TNB Zn_ribbon_RPAB4 DZR_2 HypA Motif Other DBs NCBI-ProteinID:  APH38700 UniProt:  A0A1L3Q1H2 LinkDB All DBs Position 788199..788348 Genome browser AA seq 49 aa AA seqDB search MARFPEAEERILNKKICMNCNARNAVRAVKCRKCGYKNLRVKSKEVKRG NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcaagattccccgaagctgaggaacgtatacttaacaagaagatctgcatgaattgc aatgcccgtaatgctgtaagggctgttaaatgcagaaagtgtggttacaaaaatctccgt gtaaaatccaaggaagtaaagagaggctga

DBGET integrated database retrieval system