Marinobacter nauticus ATCC 49840: MARHY1437 Help Entry MARHY1437         CDS       T02083                                  Symbol acpP Name (GenBank) acyl carrier protein (ACP)   KO K02078   acyl carrier protein Organism mhc  Marinobacter nauticus ATCC 49840 Pathway mhc01100   Metabolic pathways mhc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mhc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MARHY1437 (acpP)    00074 Mycolic acid biosynthesis     MARHY1437 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MARHY1437 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 AMPK_alpha_AID Motif Other DBs NCBI-ProteinID:  CCG94915 LinkDB All DBs Position 1494646..1494879 Genome browser AA seq 77 aa AA seqDB search MSTVEERVKKIVCEQLGVKESEVQNTSSFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKLGTVQDAIDYIVAHT NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagtacagttgaagagcgcgttaagaagattgtttgtgagcagttgggcgtgaaagag tccgaagttcagaacacatcttcttttgtagaggatcttggcgctgactcactggacact gttgagctggttatggccctggaagaggaattcgagaccgagattcctgacgaagaggcc gaaaagctgggcaccgttcaggacgcgatcgactacattgtcgcgcacacctga

DBGET integrated database retrieval system