KEGG   Marinithermus hydrothermalis: Marky_1705
Entry
Marky_1705        CDS       T01457                                 
Name
(GenBank) Adenylate kinase
  KO
K00939  adenylate kinase [EC:2.7.4.3]
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00230  Purine metabolism
mhd00730  Thiamine metabolism
mhd01100  Metabolic pathways
mhd01110  Biosynthesis of secondary metabolites
mhd01232  Nucleotide metabolism
mhd01240  Biosynthesis of cofactors
Module
mhd_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mhd00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Marky_1705
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    Marky_1705
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mhd04147]
    Marky_1705
Enzymes [BR:mhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     Marky_1705
Exosome [BR:mhd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Marky_1705
SSDB
Motif
Pfam: ADK AAA_17 AAA_33 AAA_18 Thymidylate_kin Cytidylate_kin AAA SRP54 AAA_22 AraC_N AAA_28 NACHT
Other DBs
NCBI-ProteinID: AEB12440
UniProt: F2NMQ6
LinkDB
Position
complement(1714817..1715371)
AA seq 184 aa
MVLIFLGPPGAGKGTQAARLAQDLNLKKISTGDILRAHVAQGTELGRKVKPIMDRGDLVP
DELILAIIKEELEQMPEVRAIFDGFPRTTAQAEALDRLLETLGAPIHKALLLEVPTEELV
ARLLKRAELEGRSDDNEETVRRRLEVYAEKTQPLVDYYAARGVLVRANGVGTVDEVYRRI
REAL
NT seq 555 nt   +upstreamnt  +downstreamnt
atggtgctgatctttttggggccgcccggcgcgggtaagggaacgcaagccgcccggctg
gcgcaggacctgaacctcaagaagatctccaccggggatatcctgcgcgcgcacgtcgcc
caaggtaccgagctgggccgcaaggtcaagcccatcatggaccggggggacctggttccg
gacgagctcatcctcgcgatcatcaaggaggagctcgagcaaatgcccgaggtgcgggcg
atctttgacggcttcccccggaccaccgcgcaagctgaggcgctggaccgccttctcgag
acgctcggcgcgcccattcataaggcgttgctcctcgaggtacccacggaggagctcgta
gcgcggttgttgaagcgcgcggagctcgaagggcgctcggacgacaacgaggagacggta
cgccgccgcctcgaggtgtacgcggaaaaaacccagcccctcgtggattactacgcggcg
cggggcgtgctggtgcgggcgaacggcgtgggcacggtggatgaggtgtaccgccggatc
cgggaggcgctctag

DBGET integrated database retrieval system