Methanothrix harundinacea: Mhar_1915 Help Entry Mhar_1915         CDS       T01990                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mhi  Methanothrix harundinacea Pathway mhi03010   Ribosome Brite KEGG Orthology (KO) [BR:mhi00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Mhar_1915   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Mhar_1915  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mhi03011]     Mhar_1915    04121 Ubiquitin system [BR:mhi04121]     Mhar_1915   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mhi04147]     Mhar_1915 Ribosome [BR:mhi03011]  Ribosomal proteins   Eukaryotes    Small subunit     Mhar_1915   Archaea     Mhar_1915 Ubiquitin system [BR:mhi04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Mhar_1915 Exosome [BR:mhi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Mhar_1915   Exosomal proteins of colorectal cancer cells    Mhar_1915 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e IBR DUF1451 Zn_ribbon_RPAB4 Cas12f1-like_TNB Zn_ribbon_IS1595 DZR_2 Zn_ribbon_RPB9 Lar_restr_allev Zn_ribbon_NrdR DZR Zn_ribbon_13 Zn_ribbon_19 Motif Other DBs NCBI-ProteinID:  AET65271 UniProt:  G7WQ79 LinkDB All DBs Position 2067593..2067742 Genome browser AA seq 49 aa AA seqDB search MAANEFYDLAGDAIKRKRQICPRCGNGVFLGEHKDRLACGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcggcgaacgagttctacgacctcgctggcgacgccatcaagaggaagaggcagatc tgtcccaggtgcggaaacggggtcttcctcggggagcacaaggacaggctcgcctgcgga aagtgcggatataccgagttcaagaagtga

DBGET integrated database retrieval system