Methanosarcina horonobensis: MSHOH_0824 Help Entry MSHOH_0824        CDS       T03933                                  Name (GenBank) SSU ribosomal protein S27Ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mhor  Methanosarcina horonobensis Pathway mhor03010   Ribosome Brite KEGG Orthology (KO) [BR:mhor00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MSHOH_0824   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MSHOH_0824  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mhor03011]     MSHOH_0824    04121 Ubiquitin system [BR:mhor04121]     MSHOH_0824   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mhor04147]     MSHOH_0824 Ribosome [BR:mhor03011]  Ribosomal proteins   Eukaryotes    Small subunit     MSHOH_0824   Archaea     MSHOH_0824 Ubiquitin system [BR:mhor04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MSHOH_0824 Exosome [BR:mhor04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MSHOH_0824   Exosomal proteins of colorectal cancer cells    MSHOH_0824 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_Nudix Ribosomal_L37e DUF6671 IBR_1 Zn_ribbon_RPB9 MqsA_antitoxin DUF1451 Cas12f1-like_TNB Zn_ribbon_IS1595 Lar_restr_allev Zn_ribbon_NOB1 Zn_Ribbon_TF Motif Other DBs NCBI-ProteinID:  AKB77307 UniProt:  A0A0E3SBU2 LinkDB All DBs Position complement(981028..981177) Genome browser AA seq 49 aa AA seqDB search MAVKDYYKVQGDSVTRLKQFCPRCGPGVFLAEHKNRLACGKCGYTEFKK NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggcagtaaaagattattacaaagtccagggcgactccgtaaccagactcaaacagttc tgtcccagatgcggacccggcgtattccttgccgaacacaaaaaccgccttgcctgcgga aagtgcggctacaccgaattcaagaaataa

DBGET integrated database retrieval system