Mesomycoplasma hyorhinis DBS 1050: Q453_0405 Help Entry Q453_0405         CDS       T02927                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mhv  Mesomycoplasma hyorhinis DBS 1050 Pathway mhv01100   Metabolic pathways mhv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mhv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Q453_0405 (acpP)    00074 Mycolic acid biosynthesis     Q453_0405 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Q453_0405 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 ACP_SdgA_C PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AHA41141 LinkDB All DBs Position complement(463449..463667) Genome browser AA seq 72 aa AA seqDB search MKKLIYDKLKSYSNKSIHDDSDIYSIGLDSLDFVELITELEEKYNIEITDEELLKAKTVK DVIDLVESKVKK NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaactaatttatgataaattaaaaagttattctaataaaagcatacatgatgat tctgatatctattcaattggtttagattctttggattttgtagaattaataactgaatta gaagaaaaatataatattgaaataaccgatgaagagctattaaaagcaaaaactgtaaaa gatgtaatcgacttagttgaatctaaagttaaaaaatag

DBGET integrated database retrieval system