Candidatus Beckwithbacteria bacterium GW2011_GWC1_49_16: UY43_C0001G1003
Help
Entry
UY43_C0001G1003 CDS
T04022
Name
(GenBank) 50S ribosomal protein L18, large subunit ribosomal protein L18
KO
K02881
large subunit ribosomal protein L18
Organism
mib
Candidatus Beckwithbacteria bacterium GW2011_GWC1_49_16
Pathway
mib03010
Ribosome
Brite
KEGG Orthology (KO) [BR:
mib00001
]
09120 Genetic Information Processing
09122 Translation
03010 Ribosome
UY43_C0001G1003
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03011 Ribosome [BR:
mib03011
]
UY43_C0001G1003
Ribosome [BR:
mib03011
]
Ribosomal proteins
Mitochondria/ Chloroplast
Large subunit
UY43_C0001G1003
Bacteria
UY43_C0001G1003
Archaea
UY43_C0001G1003
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L18p
DUF6563
CRS1_YhbY
Acanthaporin
Motif
Other DBs
NCBI-ProteinID:
AKM79717
LinkDB
All DBs
Position
complement(895332..895658)
Genome browser
AA seq
108 aa
AA seq
DB search
MQQRKLRVRAKIRRVNLPRLSVFRSGKQIYAQIIEPKTGNILASASSLKLKKTAAIKKTK
LAESVGEAIAAAAKPKKIIKVVFDRGGFRYHGRVKALAEAARKGGLKF
NT seq
327 nt
NT seq
+upstream
nt +downstream
nt
atgcaacaaagaaagttacgagtccgcgccaaaatccgccgggtaaacttaccccggctg
tcggtctttcgttcgggcaaacaaatctacgcccagattatcgaacccaaaaccggcaac
attttagcttctgcctcaagcttgaagcttaaaaaaactgccgctatcaaaaagaccaag
ctggccgaatcagtcggggaggccatcgccgctgccgccaaacccaaaaaaattattaaa
gtggtttttgaccgcggcggcttccgctaccacggccgggtcaaagccctggctgaagca
gcccgcaaaggtggtttaaaattctaa
DBGET
integrated database retrieval system