Allocoleopsis franciscana: Mic7113_0076 Help Entry Mic7113_0076      CDS       T02374                                  Name (GenBank) cytochrome b559, beta subunit   KO K02708   photosystem II cytochrome b559 subunit beta Organism mic  Allocoleopsis franciscana Pathway mic00195   Photosynthesis mic01100   Metabolic pathways Module mic_M00161   Photosystem II mic_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:mic00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     Mic7113_0076  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mic00194]     Mic7113_0076 Photosynthesis proteins [BR:mic00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     Mic7113_0076 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559 Motif Other DBs NCBI-ProteinID:  AFZ16017 UniProt:  K9W931 LinkDB All DBs Position 80908..81042 Genome browser AA seq 44 aa AA seqDB search MTGNTPNQPISYPIFTVRWLAVHTLGVPTVFFLGAIAAMQFIQR NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgacaggtaatactccaaatcaacccatttcttatccaatttttacagttagatggcta gctgttcatacactgggcgtgccgactgttttcttcttgggcgcgatcgcagctatgcag tttatccaacgttag

DBGET integrated database retrieval system