Allocoleopsis franciscana: Mic7113_3826 Help Entry Mic7113_3826      CDS       T02374                                  Name (GenBank) hypothetical protein   KO K02707   photosystem II cytochrome b559 subunit alpha Organism mic  Allocoleopsis franciscana Pathway mic00195   Photosynthesis mic01100   Metabolic pathways Module mic_M00161   Photosystem II mic_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:mic00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     Mic7113_3826  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mic00194]     Mic7113_3826 Photosynthesis proteins [BR:mic00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     Mic7113_3826 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Cytochrom_B559a Motif Other DBs NCBI-ProteinID:  AFZ19543 UniProt:  K9WH71 LinkDB All DBs Position complement(4433430..4433567) Genome browser AA seq 45 aa AA seqDB search MPKELVVLLLFFLVAYVVASGLEYGTFGVPRPTEYFTPEVIESNG NT seq 138 nt NT seq  +upstreamnt  +downstreamnt atgcctaaagaattagtggtattgttgcttttttttctggtggcctatgtggtggcaagc ggattggagtatggaacttttggtgtaccgcgtccgaccgaatacttcacaccagaggta atcgagagtaacggctag

DBGET integrated database retrieval system