Micromonospora sp. B006: MicB006_2543 Help Entry MicB006_2543      CDS       T05583                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism micb  Micromonospora sp. B006 Pathway micb00998   Biosynthesis of various antibiotics micb01100   Metabolic pathways micb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:micb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MicB006_2543    00074 Mycolic acid biosynthesis     MicB006_2543   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MicB006_2543 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AXO34824 LinkDB All DBs Position complement(2656557..2656820) Genome browser AA seq 87 aa AA seqDB search MRDEVRTFVVEQLADMNYDVEELDDDTTLGPSGVDLESLALADLAVRVEDRYGLKFADDE SEKLALMTVGEFITMVADRVAANSDKS NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgcgagacgaggtccgcaccttcgtcgtcgagcagctcgccgacatgaactacgacgtg gaggagctcgacgacgacaccacgctcggcccttccggcgtcgacctggagtcgctggcc ctggccgacctcgcggtccgcgtcgaggaccggtacggcctgaagttcgccgacgacgag tcggagaagctggcgttgatgacggtcggcgagttcatcacgatggtcgccgaccgggtg gccgcgaacagcgacaagtcctga

DBGET integrated database retrieval system