Micromonospora sp. B006: MicB006_4304 Help Entry MicB006_4304      CDS       T05583                                  Name (GenBank) glutaredoxin protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism micb  Micromonospora sp. B006 Brite KEGG Orthology (KO) [BR:micb00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     MicB006_4304 Enzymes [BR:micb01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      MicB006_4304 SSDB OrthologParalogGFIT Motif Pfam:  Glutaredoxin GST_N_2 Glrx-like GST_N_3 Thioredoxin_2 Thioredoxin GST_N Motif Other DBs NCBI-ProteinID:  AXO36571 LinkDB All DBs Position 4770007..4770249 Genome browser AA seq 80 aa AA seqDB search MLTMYSTPWCGYCHRLKSQLDREGIAYEVVDIEQDPAAADFVMSVNGGNQTVPTLRFADG SALTNPSITQVKQHLAALPG NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgttgacgatgtattccaccccgtggtgcggctactgccaccggctgaagtcgcagctc gaccgggagggcatcgcgtacgaggtggtcgacatcgagcaggaccccgcggccgcggac ttcgtgatgagcgtcaacggcggcaaccagaccgtcccgacgctgcgcttcgccgacggc agcgccctgaccaacccctcgatcacccaggtcaagcagcacctggccgcgctccccggc tga

DBGET integrated database retrieval system