Microbulbifer aggregans: AUP74_02555 Help Entry AUP74_02555       CDS       T04560                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism micc  Microbulbifer aggregans Pathway micc01100   Metabolic pathways micc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:micc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AUP74_02555    00074 Mycolic acid biosynthesis     AUP74_02555   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AUP74_02555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  AOS97952 UniProt:  A0A1C9W9Y9 LinkDB All DBs Position 2911977..2912240 Genome browser AA seq 87 aa AA seqDB search MTRNEISSLVLEKLLQVAPDIDQNALAPDIPVRDQYDFDSMDFLNFVIAIGREFQMDIPE RDYPMLQSVNGAVDYLVANLHSGISGE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgacgcggaatgaaatcagcagtttggtgctggagaaactgctgcaggtggcaccggac attgatcagaatgcactcgccccggatattccggtgcgggatcagtatgatttcgactcg atggattttctcaattttgtcatcgccatcggtcgcgagtttcagatggatatcccagag cgggactatccaatgctgcaaagtgtcaatggtgccgtcgactacctggttgccaacctc catagcggaatctccggtgaataa

DBGET integrated database retrieval system