Microbacterium sp. RG1: EHF32_13065 Help Entry EHF32_13065       CDS       T10164                                  Name (GenBank) integration host factor   KO K03530   DNA-binding protein HU-beta Organism mice  Microbacterium sp. RG1 Brite KEGG Orthology (KO) [BR:mice00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mice03032]     EHF32_13065    03036 Chromosome and associated proteins [BR:mice03036]     EHF32_13065    03400 DNA repair and recombination proteins [BR:mice03400]     EHF32_13065 DNA replication proteins [BR:mice03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     EHF32_13065 Chromosome and associated proteins [BR:mice03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     EHF32_13065 DNA repair and recombination proteins [BR:mice03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       EHF32_13065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF937 HU-CCDC81_euk_2 HTH_26 SSB LacI PSF3_N Motif Other DBs NCBI-ProteinID:  QCQ17580 UniProt:  A0A4P8KS82 LinkDB All DBs Position 2678332..2678619 Genome browser AA seq 95 aa AA seqDB search MADKSITKTELVASIASATGQSQSTVSSVLDSLFSTVSEAVAKGTKVSIPGWIAFEQVET SARTGRNPQTGAEIAIPAGKRVKVTAGSKLKAAVK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggccgacaagtccatcaccaagaccgagctcgtcgcgagcatcgccagcgccacggga cagagccagtccaccgtgtcgagcgtgctcgactccctcttctccacggtctccgaggcc gtcgccaagggcaccaaggtctccatccccggttggatcgcgttcgagcaggtcgagacc tccgctcgcaccggccgcaacccgcagaccggcgccgagatcgccatccccgccggcaag cgcgtcaaggtgaccgccggttcgaagctcaaggccgccgtcaagtaa

DBGET integrated database retrieval system