Micromonospora sp. HM134: FJK98_16410 Help Entry FJK98_16410       CDS       T06145                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mich  Micromonospora sp. HM134 Pathway mich00998   Biosynthesis of various antibiotics mich01100   Metabolic pathways mich01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mich00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FJK98_16410    00074 Mycolic acid biosynthesis     FJK98_16410   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FJK98_16410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QDY08537 LinkDB All DBs Position 3847813..3848079 Genome browser AA seq 88 aa AA seqDB search MRDEVRTFVIDQLQDMNYDVDGIDDDTTLGPSGVDLESLALSDLSVRVEDRYGLRFADDE SEKLALMTVGEFTTMVADRVAGATTDNR NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgcgagacgaggtccgtaccttcgtcatcgaccagctccaggacatgaactacgacgtc gacgggatcgacgacgacaccacgctcggcccgtccggggtggacctggagtcgctcgcc ctgtccgacctgtccgtccgggtggaggaccggtacgggctgcggttcgccgacgacgag tcggagaagctggccctgatgacggtgggggagttcaccaccatggtcgccgaccgggtc gccggggcgaccaccgacaaccgctga

DBGET integrated database retrieval system