Micromonospora sp. HM134: FJK98_26910 Help Entry FJK98_26910       CDS       T06145                                  Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism mich  Micromonospora sp. HM134 Pathway mich00190   Oxidative phosphorylation mich01100   Metabolic pathways Module mich_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:mich00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     FJK98_26910  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:mich00194]     FJK98_26910 Photosynthesis proteins [BR:mich00194]  Photosystem and electron transport system   F-type ATPase [OT]    FJK98_26910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C Motif Other DBs NCBI-ProteinID:  QDY10329 UniProt:  A0A518WM56 LinkDB All DBs Position complement(6212087..6212320) Genome browser AA seq 77 aa AA seqDB search MDASVLAEVTGSTAAIGYGLAAIGPGIGVGLVFAAYIQSTARQPESSRMTLPYVWIGFAV IEALALLGIAFGFIWAG NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggacgctagcgttctcgccgaggtcaccggcagcaccgccgccatcggctacggcctc gccgccatcggcccgggcatcggcgtcggcctggtcttcgccgcctacatccagtcgacg gcccgccagccggagtcgtcccggatgaccctgccgtacgtctggatcggcttcgccgtc atcgaggcgctcgcgctgctgggcatcgccttcggcttcatctgggccggctga

DBGET integrated database retrieval system