Microbacterium sp. HA-8: AB2L57_16960 Help Entry AB2L57_16960      CDS       T10924                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism mici  Microbacterium sp. HA-8 Brite KEGG Orthology (KO) [BR:mici00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:mici03032]     AB2L57_16960    03036 Chromosome and associated proteins [BR:mici03036]     AB2L57_16960    03400 DNA repair and recombination proteins [BR:mici03400]     AB2L57_16960 DNA replication proteins [BR:mici03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     AB2L57_16960 Chromosome and associated proteins [BR:mici03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     AB2L57_16960 DNA repair and recombination proteins [BR:mici03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       AB2L57_16960 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HTH_26 DUF937 HU-CCDC81_euk_2 DUF4777 LacI PSF3_N Motif Other DBs NCBI-ProteinID:  XLP03379 LinkDB All DBs Position complement(3548734..3549021) Genome browser AA seq 95 aa AA seqDB search MADKSITKTELVASIASATGESQATVSRVVDGLFSTVSEAVAKGTKVSIPGWIAFEQVET AARTGRNPQTGEEIKIAAGKRVKVTAGSKLKAAAK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggccgacaagtccatcaccaagaccgagctcgtcgcgagcatcgccagcgccacgggc gagagccaggccacggtctcgcgcgtcgtcgacggtctgttctcgacggtgtctgaggcc gtcgccaagggcaccaaggtctcgatcccgggctggatcgcgttcgagcaggtcgagacg gccgctcgcacgggccgcaacccccagaccggcgaagagatcaagatcgccgcgggcaag cgcgtcaaggtcaccgcgggctcgaagctcaaggctgccgcgaagtag

DBGET integrated database retrieval system