Microbulbifer sp. SH-1: GNX18_06315 Help Entry GNX18_06315       CDS       T10373                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism micl  Microbulbifer sp. SH-1 Brite KEGG Orthology (KO) [BR:micl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:micl03032]     GNX18_06315    03036 Chromosome and associated proteins [BR:micl03036]     GNX18_06315    03400 DNA repair and recombination proteins [BR:micl03400]     GNX18_06315 DNA replication proteins [BR:micl03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GNX18_06315 Chromosome and associated proteins [BR:micl03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GNX18_06315 DNA repair and recombination proteins [BR:micl03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GNX18_06315 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Barstar HU-CCDC81_euk_2 NolB HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  QIL89419 UniProt:  A0A6G8DDW0 LinkDB All DBs Position complement(1438924..1439196) Genome browser AA seq 90 aa AA seqDB search MNKSELIEAIAASADIPKAAAGRALDAMVESITDALKKGDQVALVGFGTFAVKERAARTG RNPRTGDPIEIAAAKIPNFKAGKALKDAVQ NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaataagtccgaactgattgaagccattgccgcatctgccgacattcctaaggcagct gctggccgcgctctggacgccatggtagaaagcattaccgacgcactgaaaaaaggcgat caggtggccctggttggctttggcacttttgctgtgaaagagcgtgcggcgcgtactggt cgcaacccgcgtactggcgatcctatcgaaatcgccgcggcaaaaattccgaacttcaaa gctggcaaagctttgaaagacgcggtgcaataa

DBGET integrated database retrieval system