Microbacterium sp. che218: CHE218_07760 Help Entry CHE218_07760      CDS       T10698                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism micm  Microbacterium sp. che218 Pathway micm03060   Protein export micm03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:micm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CHE218_07760  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     CHE218_07760  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:micm02044]     CHE218_07760 Secretion system [BR:micm02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    CHE218_07760 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  BFM23734 LinkDB All DBs Position complement(832223..832462) Genome browser AA seq 79 aa AA seqDB search MLQNLTGWHALIVLAVIVLIFGAAKLPALARSLGQSVRILKTEVSESRADAAAEPDPQAP ARAQGASASASVLAPPSAP NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgctgcagaacctcaccggctggcacgcgctgatcgtgctggcggtcatcgtcctcatc ttcggagccgccaagctccccgccctcgcccgcagcctcggtcagtcggtgcgcatcctc aagaccgaggtgagcgagtcccgcgcggacgccgccgccgagcccgacccgcaggccccg gcccgggcgcagggcgcgtccgcttcggcatccgtcctcgcacccccgagcgcgccgtga

DBGET integrated database retrieval system