Microbacterium sp. che218: CHE218_15240 Help Entry CHE218_15240      CDS       T10698                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism micm  Microbacterium sp. che218 Pathway micm03060   Protein export micm03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:micm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CHE218_15240  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     CHE218_15240  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:micm02044]     CHE218_15240 Secretion system [BR:micm02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    CHE218_15240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Hanta_Gc_C Motif Other DBs NCBI-ProteinID:  BFM24482 LinkDB All DBs Position 1617633..1617878 Genome browser AA seq 81 aa AA seqDB search MGIFGNAFSGWHLLLILAVVLLLFGAAKLPSLAKSVGESVRILRAETREAKGDKAEPASA PSSATTNDQPGRNPSGSSSST NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgggtattttcggcaatgcgttctctggctggcacctgctcctcatcctggcggtcgtc cttctcttgttcggtgcggccaagctgccaagccttgccaagagcgtcggtgaatcggtt cgcattctccgtgccgagacgcgcgaggcgaagggcgacaaggcggagcccgcgtcggcg ccctcttccgcgacgacgaacgatcagccgggccgcaatccgtcaggctcgtcgtcgtcc acgtga

DBGET integrated database retrieval system