Microbacterium sp. che218: CHE218_22060 Help Entry CHE218_22060      CDS       T10698                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism micm  Microbacterium sp. che218 Brite KEGG Orthology (KO) [BR:micm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:micm03032]     CHE218_22060    03036 Chromosome and associated proteins [BR:micm03036]     CHE218_22060    03400 DNA repair and recombination proteins [BR:micm03400]     CHE218_22060 DNA replication proteins [BR:micm03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CHE218_22060 Chromosome and associated proteins [BR:micm03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CHE218_22060 DNA repair and recombination proteins [BR:micm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CHE218_22060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF937 HU-CCDC81_euk_2 PSF3_N Motif Other DBs NCBI-ProteinID:  BFM25164 LinkDB All DBs Position 2327330..2327617 Genome browser AA seq 95 aa AA seqDB search MADKSITKTELVASIASATGQSQSAVSGVLDSLFSTVSEAVAKGSKVSIPGWIAFEQVAT SARTGRNPQTGEEISIPAGKRVKVTAGSKLKAAVK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atggccgacaagtccatcaccaagaccgagctcgtcgcgagcatcgccagcgcgaccggg cagagccagtccgccgtgtcgggcgtgctcgactccctcttctccaccgtctccgaggcg gtcgccaagggcagcaaggtctcgatccccggttggatcgccttcgagcaggtcgcgacc tcggcgcgcaccggccgcaacccgcagacgggtgaggagatctccatccccgccggcaag cgcgtcaaggtgaccgctggctccaagctcaaggccgccgtcaagtaa

DBGET integrated database retrieval system