Microbacterium sp. che218: CHE218_25120 Help Entry CHE218_25120      CDS       T10698                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism micm  Microbacterium sp. che218 Pathway micm03060   Protein export micm03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:micm00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     CHE218_25120  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     CHE218_25120  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:micm02044]     CHE218_25120 Secretion system [BR:micm02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    CHE218_25120 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TatA_B_E DUF6574 Motif Other DBs NCBI-ProteinID:  BFM25470 LinkDB All DBs Position 2659767..2660006 Genome browser AA seq 79 aa AA seqDB search MLHGLTGWHLLIVLAVVVLLFGAAKLPALAQSVGKSARLFKGELKAMKDDDTATLAESAA PAVPDARVSAVIADPPPTR NT seq 240 nt NT seq  +upstreamnt  +downstreamnt gtgctccatggactgaccggatggcatctgctgatcgtcctggcggtggtcgtgctcctc ttcggggccgcgaaactgccggcgctggctcagagcgtgggcaagtcggcccggctgttc aagggcgagctgaaggccatgaaggacgacgacacggcgacgctcgcggaatcggccgcg ccggccgttcccgacgcacgcgtctcggcggtcatcgccgacccgcccccgacccgctga

DBGET integrated database retrieval system