Micromonospora sp. SH-82: WHN02_21065 Help Entry WHN02_21065       CDS       T11153                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism micn  Micromonospora sp. SH-82 Pathway micn00998   Biosynthesis of various antibiotics micn01100   Metabolic pathways micn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:micn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     WHN02_21065    00074 Mycolic acid biosynthesis     WHN02_21065   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     WHN02_21065 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  XXG06665 LinkDB All DBs Position complement(4795812..4796066) Genome browser AA seq 84 aa AA seqDB search MTVTIDQVGPDVAALTRKLMTDDVDRDINPGDTFVELGLDSLKLVDLLAAAESHFDIEVP DEEVGNFTTVQDLVDFVVANRPTV NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccgtgaccatcgaccaggtcggcccggacgtcgccgccctgacccgcaagctgatg accgacgacgtcgaccgggacatcaaccccggcgacaccttcgtcgagctgggcctggac agcctcaagctggtcgacctgctggccgcggcggagtcgcacttcgacatcgaggtcccc gacgaggaggtcgggaacttcaccaccgtccaggacctcgtcgacttcgtcgtggccaac cggccgacggtgtga

DBGET integrated database retrieval system