Microvirga thermotolerans: GDR74_17140 Help Entry GDR74_17140       CDS       T06255                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism mico  Microvirga thermotolerans Brite KEGG Orthology (KO) [BR:mico00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:mico03110]     GDR74_17140 (grxC) Chaperones and folding catalysts [BR:mico03110]  Protein folding catalysts   Protein disulfide isomerase    GDR74_17140 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin SH3BGR GST_N_2 GST_N_3 Glrx-like Thioredoxin_2 TXD17-like_Trx Thioredoxin_3 Motif Other DBs NCBI-ProteinID:  QFU17803 UniProt:  A0A5P9JZD2 LinkDB All DBs Position 3617426..3617683 Genome browser AA seq 85 aa AA seqDB search MPPITIYTKSWCPYCAAAKRLLEEKGAAFDEIDIEAEPERRAEMVQKAGGRTTVPQIFIG NRHVGGCDDLYALDERGELERLLAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgccgccgatcacgatctacaccaagagctggtgcccctattgcgccgccgccaagagg cttctcgaggagaagggcgccgccttcgacgaaatcgacatcgaggccgagcccgagcgc cgcgcggagatggtgcagaaggccggaggccgcaccaccgtgccgcagatcttcatcggc aaccgccacgtgggcggctgcgacgatctctacgccctggacgagaggggcgagcttgag aggctcctggcagcctag

DBGET integrated database retrieval system