Microbacterium sp. 1.5R: BMW26_09230 Help Entry BMW26_09230       CDS       T04912                                  Name (GenBank) hypothetical protein   KO K03530   DNA-binding protein HU-beta Organism micr  Microbacterium sp. 1.5R Brite KEGG Orthology (KO) [BR:micr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:micr03032]     BMW26_09230    03036 Chromosome and associated proteins [BR:micr03036]     BMW26_09230    03400 DNA repair and recombination proteins [BR:micr03400]     BMW26_09230 DNA replication proteins [BR:micr03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BMW26_09230 Chromosome and associated proteins [BR:micr03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BMW26_09230 DNA repair and recombination proteins [BR:micr03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BMW26_09230 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 DUF2267 Motif Other DBs NCBI-ProteinID:  APH45114 LinkDB All DBs Position complement(1952770..1953084) Genome browser AA seq 104 aa AA seqDB search MSTSRTLETNRVSKREFVQRFARRGGISVQAAQTAYNAMIDELLDLVGRGNTVTLTNFGK FYPQTHKGHRVQFAKDDGDAEVNDYTVLKFSATREVNRRVKVND NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgagcacatcaaggacgctcgagacgaatcgggtgagcaagcgggagttcgtgcagaga ttcgcacgacgcggtggcatctcggttcaggccgcacagacggcgtacaacgcgatgatc gacgagctcctcgacctcgtgggccgcgggaacacggtcacactcaccaacttcggcaag ttctatccgcagacgcacaaggggcaccgggtgcagttcgcgaaggacgacggagacgcc gaggtcaacgactacaccgtgctgaagttctccgcgacgcgcgaggtgaaccgccgcgtc aaggtgaacgattag

DBGET integrated database retrieval system