KEGG   Microbulbifer sp. THAF38: FIU95_02460
Entry
FIU95_02460       CDS       T06274                                 
Symbol
rplR
Name
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
mict  Microbulbifer sp. THAF38
Pathway
mict03010  Ribosome
Brite
KEGG Orthology (KO) [BR:mict00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FIU95_02460 (rplR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:mict03011]
    FIU95_02460 (rplR)
Ribosome [BR:mict03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FIU95_02460 (rplR)
  Bacteria
    FIU95_02460 (rplR)
  Archaea
    FIU95_02460 (rplR)
SSDB
Motif
Pfam: Ribosomal_L18p TGS DUF2259
Other DBs
NCBI-ProteinID: QFT53436
LinkDB
Position
555949..556299
AA seq 116 aa
MNVKKASRLRRARRARAKIRELGAVRLTVNRTPRHIYAQILSAEGNSVLASASTLDKDLR
EGKTGNADAASAVGKLIAERAKAAGVEEVAFDRSGFKYHGRIKALADAAREAGLKF
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaacgttaagaaagcatctcgcttgcgtcgtgcacgtcgtgcccgcgctaagatccgt
gagctgggcgccgttcgcctcaccgtgaaccgcacaccgcgtcacatttacgcacagatc
ctgtctgccgaaggcaactcggtattggcttccgcctctaccctggacaaggacctgcgc
gaaggtaaaaccggtaacgccgatgccgcttccgcggttggcaaactgatcgctgagcgc
gcgaaagccgctggtgttgaagaagttgccttcgatcgcagtggcttcaagtaccatggc
cgtattaaggctttggctgacgctgcccgcgaagccggtctgaaattctaa

DBGET integrated database retrieval system