Microbulbifer sp. THAF38: FIU95_14885 Help Entry FIU95_14885       CDS       T06274                                  Symbol ftsB Name (GenBank) Cell division protein FtsB   KO K05589   cell division protein FtsB Organism mict  Microbulbifer sp. THAF38 Brite KEGG Orthology (KO) [BR:mict00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mict03036]     FIU95_14885 (ftsB) Chromosome and associated proteins [BR:mict03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     FIU95_14885 (ftsB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DivIC CENP-H ZapB YabA XRCC4_CC HALZ SlyX DUF7206 Motif Other DBs NCBI-ProteinID:  QFT55834 UniProt:  A0A5P9EZU6 LinkDB All DBs Position complement(3292009..3292296) Genome browser AA seq 95 aa AA seqDB search MKWLLGILTFILLATQYRVWVGDGSLAEVTRLKRQLVQQQEKNAALARENRQLLREVRSL KEGTDGVEAKARYDLGLIKEGETLFIFLDSEEAKK NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgaaatggctgctgggaattcttacctttattctgcttgccactcagtatcgtgtctgg gtcggtgatggcagtctcgccgaagttacccgtctcaaacgacaactcgtccaacaacag gaaaaaaatgcagccttggcgcgggaaaatcgccagttgttgagagaagtgcgaagcctg aaagagggcactgatggtgtcgaagccaaggcacgctatgatctggggttgattaaggaa ggggaaaccctgtttatcttcctggattcggaagaggctaaaaagtga

DBGET integrated database retrieval system