Microbulbifer sp. GL-2: GL2_35040 Help Entry GL2_35040         CDS       T07982                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism micz  Microbulbifer sp. GL-2 Pathway micz03060   Protein export micz03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:micz00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     GL2_35040  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     GL2_35040  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:micz02044]     GL2_35040 Secretion system [BR:micz02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    GL2_35040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  BBM03430 UniProt:  A0A510IXD5 LinkDB All DBs Position 3976855..3977073 Genome browser AA seq 72 aa AA seqDB search MGISGISVWQILIVLMLAVLLFGSGKIRRMGEDLGGTISGFRRSLRKGEGDSLDVDSQDD LSGKLIQSGERQ NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgggtatttccggaatcagcgtttggcaaatcctgatagtccttatgctggcggtgctg ctgttcggcagcggcaagatccgccgtatgggagaggaccttggtgggactattagtgga ttccgcaggtcgttgcgaaagggcgaaggggatagccttgatgttgattcccaagatgat ttgtctggaaaattgattcagtcaggggagcggcaatga

DBGET integrated database retrieval system